hnRNP A1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57121

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57121
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all hnRNP A1 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HNRPA1 (heterogeneous nuclear ribonucleoprotein A1) The peptide sequence was selected from the N terminal of HNRPA1. Peptide sequence MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for hnRNP A1 Antibody

Western Blot: hnRNP A1 Antibody [NBP1-57121]

Western Blot: hnRNP A1 Antibody [NBP1-57121]

Western Blot: hnRNP A1 Antibody [NBP1-57121] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry: hnRNP A1 Antibody [NBP1-57121]

Immunohistochemistry: hnRNP A1 Antibody [NBP1-57121]

Immunohistochemistry: hnRNP A1 Antibody [NBP1-57121] - Human Heart cell Cellular data: cardiac cell of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP1-57121]

Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP1-57121]

Immunohistochemistry-Paraffin: hnRNP A1 Antibody [NBP1-57121] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.
View 1 more images

Applications for hnRNP A1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 3 using NBP1-57121 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP A1

HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re-imported. Its M9 domain acts as both a nuclear localization and nuclear export signal. The encoded protein is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition. Multiple alternatively spliced transcript variants have been found for this gene but only two transcripts are fully described. These variants have multiple alternative transcription initiation sites and multiple polyA sites.

Alternate Names

Helix-destabilizing protein, heterogeneous nuclear ribonucleoprotein A1, heterogeneous nuclear ribonucleoprotein A1B protein, heterogeneous nuclear ribonucleoprotein B2 protein, heterogeneous nuclear ribonucleoprotein core protein A1, hnRNP A1, hnRNP core protein A1, hnRNPA1, hnRNP-A1, HNRPA1MGC102835, nuclear ribonucleoprotein particle A1 protein, single-strand DNA-binding protein UP1, Single-strand RNA-binding protein

Gene Symbol

HNRNPA1

UniProt

Q6IPF2 (Human)

Additional hnRNP A1 Products

Product Documents for hnRNP A1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for hnRNP A1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.