hnRNP L Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38675

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38675
NBP2-38675-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all hnRNP L Antibodies »

Product Summary for hnRNP L Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP L Antibody

Western Blot: hnRNP L Antibody [NBP2-38675]

Western Blot: hnRNP L Antibody [NBP2-38675]

Western Blot: hnRNP L Antibody [NBP2-38675] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: hnRNP L Antibody [NBP2-38675]

Immunocytochemistry/ Immunofluorescence: hnRNP L Antibody [NBP2-38675]

Immunocytochemistry/Immunofluorescence: hnRNP L Antibody [NBP2-38675] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: hnRNP L Antibody [NBP2-38675]

Immunohistochemistry-Paraffin: hnRNP L Antibody [NBP2-38675]

Immunohistochemistry-Paraffin: hnRNP L Antibody [NBP2-38675] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Applications for hnRNP L Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP L

Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (HNRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with HNRNP complexes and along with other HNRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of HNRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions.Strucutrally, hnRPL contains 2 segments of approximately 80 amino acids each which are weakly related to each other and to the ribonucleoprotein consensus sequence-type RNA-binding domains of other HNRNP and snRNP proteins.

Alternate Names

FLJ35509, heterogeneous nuclear ribonucleoprotein L, hnRNP L, hnRNP-L, HNRPL

Gene Symbol

HNRNPL

UniProt

P14866 (Human)

Additional hnRNP L Products

Product Documents for hnRNP L Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for hnRNP L Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.