HSP10/EPF Antibody (0H0X6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16604

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16604-100ul
NBP3-16604-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0H0X6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all HSP10/EPF Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human HSP10/EPF (P61604). GSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HSP10/EPF Antibody (0H0X6)

Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Western blot analysis of extracts of various cell lines, using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunocytochemistry/ Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunocytochemistry/Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunofluorescence analysis of NIH-3T3 cells using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604]

Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded mouse kidney using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 3 more images

Applications for HSP10/EPF Antibody (0H0X6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HSP10/EPF

Hsp10 make up a family of small heat shock proteins with an approximate molecular mass of 10 kDa (Hsp10s). Also known as Cpn10, Hsp10 acts as a co-chaperone and interacts with members of the Hsp60 family (GroEL in E. coli) to promote proper folding of polypeptides. In chlamydia, Hsp10 is thought to interact with cHsp60, a reported immunopathological antigen, identifying Hsp10 as a potential contributor to an immunological response.

Long Name

Heat Shock 10 kDa Protein 1

Alternate Names

Chaperonin 10 Homolog, EPF, GroES, HSPE1

Gene Symbol

HSPE1

Additional HSP10/EPF Products

Product Documents for HSP10/EPF Antibody (0H0X6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for HSP10/EPF Antibody (0H0X6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.