Hsp70 interacting protein HIP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48786

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-48786
NBP2-48786-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Hsp70 interacting protein HIP Antibodies »

Product Summary for Hsp70 interacting protein HIP Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEP

Reactivity Notes

Mouse (83%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Hsp70 interacting protein HIP Antibody

Immunocytochemistry/ Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48786]

Immunocytochemistry/ Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48786]

Immunocytochemistry/Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48786] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48786]

Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48786]

Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48786] - Staining of human testis.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48786]

Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48786]

Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-48786] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
View 4 more images

Applications for Hsp70 interacting protein HIP Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hsp70 interacting protein HIP

Hsp70 interacting protein HIP is encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene.

Alternate Names

AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein

Gene Symbol

ST13

Additional Hsp70 interacting protein HIP Products

Product Documents for Hsp70 interacting protein HIP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Hsp70 interacting protein HIP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.