IGF2BP1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-57495

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-57495
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all IGF2BP1 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human IGF2BP1. Peptide sequence: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63.481 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IGF2BP1 Antibody

Western Blot: IGF2BP1 Antibody [NBP1-57495]

Western Blot: IGF2BP1 Antibody [NBP1-57495]

Western Blot: IGF2BP1 Antibody [NBP1-57495] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495]

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495]

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495] - Human lung adenocarcinoma
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495]

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495]

Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP1-57495] - Human lung adenocarcinoma.

Applications for IGF2BP1 Antibody

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGF2BP1

IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.This gene encodes a member of the IGF-II mRNA-binding protein (IMP) family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1

Entrez Gene IDs

10642 (Human)

Gene Symbol

IGF2BP1

UniProt

Q9NZI8 (Human)

Additional IGF2BP1 Products

Product Documents for IGF2BP1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for IGF2BP1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.