IKB zeta Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10987

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10987-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all IKB zeta Antibodies »

Product Summary for IKB zeta Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse IKB zeta (NP_001152866.1). Peptide sequence VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

69 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IKB zeta Antibody

Western Blot: IKB zeta Antibody [NBP3-10987]

Western Blot: IKB zeta Antibody [NBP3-10987]

Western Blot: IKB zeta Antibody [NBP3-10987] - Western blot analysis of IKB zeta in Mouse Lung lysates. Antibody dilution at 1ug/ml

Applications for IKB zeta Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IKB zeta

IkappaBzeta (also known as MAIL and INAP) is an ankyrin-repeat-containing nuclear protein that is highly homologous to the IkappaB family member Bcl-3. Transcription of IkappaBzeta is upregulated by stimulation with TLR ligands, IL-1 and IL-6 in cultured B-lymphocytes and monocytes/macrophages, but only faintly so in T-lymphocytes, fibroblasts, and endothelial cells. IkappaB-zeta preferentially associates with the NF-kappaB subunit p50 rather than p65 and recombinant IkappaB-zeta proteins inhibit the DNA binding of the p65/p50 heterodimer and the p50/p50 homodimer.

Alternate Names

FLJ30225, FLJ34463, IkappaBzeta, I-kappa-B-zeta, IkappaB-zeta, ikbzeta, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAPIkappa B-zeta variant 3, MAILIKBZikB-zeta, Molecule possessing ankyrin repeats induced by lipopolysaccharide, NF-kappa-B inhibitor zeta, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor

Gene Symbol

NFKBIZ

Additional IKB zeta Products

Product Documents for IKB zeta Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IKB zeta Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.