ILF3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-58226

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-58226
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ILF3 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ILF3 (interleukin enhancer binding factor 3, 90kDa) The peptide sequence was selected from the N terminal of ILF3. Peptide sequence ALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ILF3 Antibody

Western Blot: ILF3 Antibody [NBP1-58226]

Western Blot: ILF3 Antibody [NBP1-58226]

Western Blot: ILF3 Antibody [NBP1-58226] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
Immunohistochemistry: ILF3 Antibody [NBP1-58226]

Immunohistochemistry: ILF3 Antibody [NBP1-58226]

Immunohistochemistry: ILF3 Antibody [NBP1-58226] - Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58226]

Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58226]

Immunohistochemistry-Paraffin: ILF3 Antibody [NBP1-58226] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
View 1 more images

Applications for ILF3 Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ILF3

ILF3 may facilitate double-stranded RNA-regulated gene expression at the level of post-transcription. ILF3 can act as a translation inhibitory protein which binds to coding sequences of acid beta-glucosidase (GCase) and other mRNAs and functions at the initiation phase of GCase mRNA translation, probably by inhibiting its binding to polysomes. ILF3 can regulate protein arginine N-methyltransferase 1 activity. ILF3 may regulate transcription of the IL2 gene during T-cell activation. It can promote the formation of stable DNA-dependent protein kinase holoenzyme complexes on DNA.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of interleukin 2. NFAT binds to a sequence in the IL2 enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. The encoded protein, which is primarily localized to ribosomes, probably regulates transcription at the level of mRNA elongation. At least three transcript variants encoding three different isoforms have been found for this gene.

Alternate Names

Double-stranded RNA-binding protein 76, double-stranded RNA-binding protein, 76 kD, DRBF, DRBP76M-phase phosphoprotein 4, dsRNA binding protein NFAR-2/MPP4, interleukin enhancer binding factor 3, 90kDa, interleukin enhancer-binding factor 3, MPHOSPH4interleukin enhancer binding factor 3, 90kD, MPP4MMP4, NF90CBTF, NFAR-1, NFAR2, NFARNF110, NF-AT-90, Nuclear factor associated with dsRNA, Nuclear factor of activated T-cells 90 kDa, nuclear factor of activated T-cells, 90 kD, TCP110, TCP80, Translational control protein 80

Gene Symbol

ILF3

UniProt

Q12906-2 (Human)

Additional ILF3 Products

Product Documents for ILF3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ILF3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.