Skip to main content

Integrin alpha 4/CD49d Antibody (8M8C2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16322

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16322-100ul
NBP3-16322-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8M8C2

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4/CD49d (P13612). ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Integrin alpha 4/CD49d Antibody (8M8C2)

Western Blot: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322]

Western Blot: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322]

Western Blot: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322] - Analysis of extracts of various cell lines, using Integrin alpha 4/CD49d (ITGA4/CD49d) Rabbit mAb (NBP3-16322) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322]

Immunohistochemistry-Paraffin: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322]

Immunohistochemistry-Paraffin: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322] - Mouse testis using Integrin alpha 4/CD49d (ITGA4/CD49d) Rabbit mAb (NBP3-16322) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322]

Immunoprecipitation: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322]

Immunoprecipitation: Integrin alpha 4/CD49d Antibody (8M8C2) [NBP3-16322] - Analysis of 300ug extracts of Jurkat cells using 3ug Integrin alpha 4/CD49d antibody (NBP3-16322). Western blot was performed from the immunoprecipitate using Integrin alpha 4/CD49d antibody (NBP3-16322) at a dilition of 1:500.

Applications for Integrin alpha 4/CD49d Antibody (8M8C2)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha 4/CD49d

VLA-4 is a cell surface heterodimer in the integrin superfamily of adhesion receptors. Anti-VLA-4 antibodies inhibited cytolytic T cell activity, with inhibitory activity directed against the effector T cells rather than their targets. Thus, whereas other VLA receptors appear to mediate cell--matrix interactions, VLA-4 may have a cell--cell adhesion function. Alpha 4 stands apart from all other known integrin alpha subunit sequences because (i) alpha 4 has neither an inserted I-domain, nor a disulfide-linked C-terminal fragment, (ii) its sequence is the most unique and (iii) only alpha 4 has a potential protease cleavage site, near the middle of the coding region, which appears responsible for the characteristic 80,000 and 70,000 Mr fragments of alpha 4 (1). Unlike any other integrin alpha subunit, the intact (150 kDa) alpha 4 subunit of VLA-4 can sometimes be cleaved into two noncovalently associated fragments (80 and 70 kDa) (2). The VLA-4 integrins are indispensable for embryogenesis, haematopoiesis and immune responses, possibly because alpha4 regulates cellular functions differently from other integrins through its cytoplasmic tail (3).

Alternate Names

CD49d, ITGA4, VLA-4

Gene Symbol

ITGA4

Additional Integrin alpha 4/CD49d Products

Product Documents for Integrin alpha 4/CD49d Antibody (8M8C2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Integrin alpha 4/CD49d Antibody (8M8C2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...