integrin beta 4 binding protein Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13954

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-13954
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all integrin beta 4 binding protein Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27119753).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for integrin beta 4 binding protein Antibody

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954]

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954]

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunocytochemistry/ Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunocytochemistry/Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.
View 5 more images

Applications for integrin beta 4 binding protein Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: integrin beta 4 binding protein

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

b(2)gcn, B(2)GCN homolog, B4 integrin interactor, CAB, EIF3Ap27(BBP), eIF-6, eukaryotic translation initiation factor 3A, eukaryotic translation initiation factor 6, ITGB4BPintegrin beta 4 binding protein, p27 beta-4 integrin-binding protein, p27BBP

Gene Symbol

EIF6

Additional integrin beta 4 binding protein Products

Product Documents for integrin beta 4 binding protein Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for integrin beta 4 binding protein Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.