JIP2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10078

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10078-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all JIP2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human JIP2 (NP_036456.1). Peptide sequence SEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for JIP2 Antibody

Western Blot: JIP2 Antibody [NBP3-10078]

Western Blot: JIP2 Antibody [NBP3-10078]

Western Blot: JIP2 Antibody [NBP3-10078] - Western blot analysis of JIP2 in Human Leiomyosarcoma Tumor lysates. Antibody dilution at 1ug/ml

Applications for JIP2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: JIP2

c-Jun NH2-terminal kinases (JNKs) are distant members of the MAP kinase family. JNK1 is activated by dual phosphorylation at a Thr-Pro-Tyr motif in response to ultraviolet (UV) light, and it functions to phosphorylate c-Jun at amino terminal serine regulatory sites, Ser 63 and Ser 73, resulting in transcriptional activation. Two additional JNK family members have been identified as JNK2 and JNK3. JIP-1 (for JNK interacting protein-1) has been identified as a cytoplasmic inhibitor of JNK that retains JNK in the cytoplasm, thereby inhibiting JNK-regulated gene expression. Evidence suggests that JNK1 and JNK2 bind to JIP-1 with greater affinity than to ATF-2 and c-Jun, which are targets of the JNK signaling pathway. JIP-1 contains an amino terminal JNK binding domain and a carboxy terminal SH3 domain. ATF-2 and c-Jun also contain the JNK binding domain and are thought to compete with JIP-1 for JNK binding. Multiple splice variants of JIP-1, including JIP-1b, JIP-1c (also designated islet-brain 1 or IB-1), JIP-2a, JIP-2b and JIP-3, have been identified in brain.

Alternate Names

C-Jun-amino-terminal kinase-interacting protein 2, homologous to mouse JIP-1, IB-2, IB2JIP2Mitogen-activated protein kinase 8-interacting protein 2, islet-brain 2, Islet-brain-2, JIP-2, JNK MAP kinase scaffold protein 2, JNK MAP kinase scaffold protein JIP2, JNK-interacting protein 2, mitogen-activated protein kinase 8 interacting protein 2, PRKM8 interacting protein-like, PRKM8IPL

Gene Symbol

MAPK8IP2

Additional JIP2 Products

Product Documents for JIP2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for JIP2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.