Kelch-Like 3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87675

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87675
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

1 mg/ml

View all Kelch-Like 3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Kelch-Like 3. Peptide sequence: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Kelch-Like 3 Antibody

Western Blot: Kelch-Like 3 Antibody [NBP2-87675]

Western Blot: Kelch-Like 3 Antibody [NBP2-87675]

Western Blot: Kelch-Like 3 Antibody [NBP2-87675] - WB Suggested Anti-KLHL3 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Western Blot: Kelch-Like 3 Antibody [NBP2-87675]

Western Blot: Kelch-Like 3 Antibody [NBP2-87675]

Western Blot: Kelch-Like 3 Antibody [NBP2-87675] - Host: Rabbit. Target: KLHL3. Positive control (+): Human Ovary Tumor (T-OV). Negative control (-): Human Liver (LI). Antibody concentration: 0.5ug/ml

Applications for Kelch-Like 3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kelch-Like 3

KLHL3, also known as Kelch-like protein 3; has 3 isoforms, a 65 kDa 587 amino acid isoform A, a 61 kDa 555 amino acid isoform B, and a 56 kDa 505 amino acid isoform C; acts as a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that plays a role of regulator in ion transport of the distal nephron. The BCR(KLHL3) complex may regulate the SLC12A3/NCC subcellular location at the cell membrane by mediating ubiquitination of SLC12A3/NCC. There has been research revolving around the KLHL3 protein involvement in pharyngitis and pseudohypoaldosteronism. The protein has been shown to interact with OPRD1, GNAO1, SYT2, SYNCRIP, and GNAI1 proteins in protein ubiquitination, renal sodium ion absorption, and distal tubule morphogenesis pathways.

Alternate Names

FLJ40871, kelch-like 3 (Drosophila), kelch-like protein 3, KIAA1129kelch (Drosophila)-like 3, MGC44594

Gene Symbol

KLHL3

Additional Kelch-Like 3 Products

Product Documents for Kelch-Like 3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Kelch-Like 3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.