KIR2DL5/CD158f Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82265

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82265-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all KIR2DL5/CD158f Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5/CD158f. Peptide sequence: QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KIR2DL5/CD158f Antibody

Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265]

Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265]

Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265] - Host: Rabbit. Target Name: KIR2DL5A. Sample Type: Human Fetal Kidney. Antibody Dilution: 1.0ug/ml
Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265]

Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265]

Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265] - WB Suggested Anti-KIR2DL5A Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell
Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265]

Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265]

Western Blot: KIR2DL5/CD158f Antibody [NBP2-82265] - Sample Type: Lane 1: FALG IP'd FLAG-KIR2DL4 transfected NK92 cells Lane 2: FALG IP'd FLAG-KIR2DL5 transfected NK92 cells Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:10,000 Color/Signal Descriptions

Applications for KIR2DL5/CD158f Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIR2DL5/CD158f

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells andsubsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies amonghaplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4,KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and bywhether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduceinhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins withthe short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase bindingprotein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules;thus, KIR proteins are thought to play an important role in regulation of the immune response. (provided by RefSeq)

Long Name

Killer Cell Immunoglobulin-like Receptor, Two Domain Long Cytoplasmic Tail, 5

Alternate Names

CD158f, KIR2DL5A

Gene Symbol

KIR2DL5A

Additional KIR2DL5/CD158f Products

Product Documents for KIR2DL5/CD158f Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KIR2DL5/CD158f Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.