KIR2DL5B Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09480

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09480-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all KIR2DL5B Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5B (NP_001018091). Peptide sequence DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KIR2DL5B Antibody

Western Blot: KIR2DL5B Antibody [NBP3-09480]

Western Blot: KIR2DL5B Antibody [NBP3-09480]

Western Blot: KIR2DL5B Antibody [NBP3-09480] - WB Suggested Anti-KIR2DL5B Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Applications for KIR2DL5B Antibody

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIR2DL5B

The KIR family is composed of at least 15 members expressed by natural killer (NK) cells and a subset of T cells in primates only. KIR proteins are named based on the number of extracellular Ig-like domains (KIR2D or KIR3D) and for whether the cytoplasmic domain is long (L), or short (S). Inhibitory KIR proteins possess long cytoplasmic tails with ITIM (inhibitory) domains, and several of these molecules bind HLA Class I molecules or target cells. Activating KIR proteins have short tails; their targets are less well-known. KIR2DL4 (CD158d) is unique in that it shows both inhibitory and activating characteristics.

Long Name

Killer Cell Immunoglobulin-like Receptor, Two Domain Long Cytoplasmic Tail, 5

Alternate Names

CD158f2, KIR2DL5, KIR2DL5.2, KIR2DLX

Gene Symbol

KIR2DL5B

Additional KIR2DL5B Products

Product Documents for KIR2DL5B Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KIR2DL5B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.