KIR5.1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10361

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10361-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all KIR5.1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat KIR5.1 (NP_445766). Peptide sequence VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KIR5.1 Antibody

Western Blot: KIR5.1 Antibody [NBP3-10361]

Western Blot: KIR5.1 Antibody [NBP3-10361]

Western Blot: KIR5.1 Antibody [NBP3-10361] - Western blot analysis of KIR5.1 in Rat Thymus lysates. Antibody dilution at 1.0ug/ml

Applications for KIR5.1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIR5.1

The KIR (for inwardly rectifying potassium channel) family of potassium channels possess a greater tendency to allow potassium to flow into the cell rather than out of it. KIR4.1, also known as KIR1.2, is highly expressed in brain including glial cells, astrocytes and cortical neurons. KIR4.1 is also expressed in myelin-synthesizing oligodendrocytes and is crucial to myelination in the developing nervous system. The gene encoding human KIR4.1 maps to chromosome 1. KIR4.2, also known as KIR1.3, is expressed in kidney, lung, heart, thymus and thyroid during development. The gene encoding human KIR4.2 maps to chromosome 21 in the Down syndrome chromosome region 1, and KIR4.2 may play a role in the pathogenesis of Down's syndrome. KIR5.1 forms functional channels only by coexpression with either KIR4.1 or KIR4.2 in the kidney and pancreas. The gene encoding human KIR5.1 maps to chromosome 17.

Alternate Names

BIR9, Inward rectifier K(+) channel Kir5.1, inward rectifier K+ channel KIR5.1, inward rectifier potassium channel 16, KIR5.1, MGC33717, Potassium channel, inwardly rectifying subfamily J member 16, potassium inwardly-rectifying channel, subfamily J, member 16

Gene Symbol

KCNJ16

Additional KIR5.1 Products

Product Documents for KIR5.1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KIR5.1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.