Skip to main content

KLRC4 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-04739

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-04739-100ul
NBP3-04739-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human KLRC4 (NP_038459.1). MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KLRC4 Antibody - Azide and BSA Free

Western Blot: KLRC4 AntibodyAzide and BSA Free [NBP3-04739]

Western Blot: KLRC4 AntibodyAzide and BSA Free [NBP3-04739]

Western Blot: KLRC4 Antibody [NBP3-04739] - Analysis of extracts of various cell lines, using KLRC4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
KLRC4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: KLRC4 Antibody - Azide and BSA Free [NBP3-04739] -

Immunocytochemistry/ Immunofluorescence: KLRC4 Antibody - Azide and BSA Free [NBP3-04739] - Immunofluorescence analysis of Jurkat cells using KLRC4 Rabbit pAb (A14807) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
KLRC4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: KLRC4 Antibody - Azide and BSA Free [NBP3-04739] -

Immunocytochemistry/ Immunofluorescence: KLRC4 Antibody - Azide and BSA Free [NBP3-04739] - Immunofluorescence analysis of paraffin-embedded mouse spleen using KLRC4 Rabbit pAb (A14807) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for KLRC4 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KLRC4

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC4 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. The 3' end of the KLRC4 transcript includes the first non-coding exon found at the 5' end of the adjacent D12S2489E gene transcript. [provided by RefSeq]

Long Name

Killer Cell Lectin Like Receptor C4

Alternate Names

NKG2F

Gene Symbol

KLRC4

Additional KLRC4 Products

Product Documents for KLRC4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for KLRC4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov