Skip to main content

LMP2/PSMB9 Antibody (7Q2G4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16823

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16823-100ul
NBP3-16823-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7Q2G4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human LMP2/PSMB9 (P28065). QREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LMP2/PSMB9 Antibody (7Q2G4)

Western Blot: LMP2/PSMB9 Antibody (7Q2G4) [NBP3-16823]

Western Blot: LMP2/PSMB9 Antibody (7Q2G4) [NBP3-16823]

Western Blot: LMP2/PSMB9 Antibody (7Q2G4) [NBP3-16823] - Western blot analysis of extracts of various cell lines, using LMP2/PSMB9 Rabbit mAb (NBP3-16823) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: LMP2/PSMB9 Antibody (7Q2G4) [NBP3-16823]

Immunohistochemistry-Paraffin: LMP2/PSMB9 Antibody (7Q2G4) [NBP3-16823]

Immunohistochemistry-Paraffin: LMP2/PSMB9 Antibody (7Q2G4) [NBP3-16823] - Immunohistochemistry of paraffin-embedded human lung cancer using LMP2/PSMB9 Rabbit mAb (NBP3-16823) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for LMP2/PSMB9 Antibody (7Q2G4)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LMP2/PSMB9

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. LMP2 is a catalytic subunit of the 20S proteasome and, upon interferon gamma-induction, replaces the delta subunit. LMP2 alters the specificity of the 20S proteasome and is critical for the production of MHC class I ligands, production of T-lymphocytes, and is suggested to increase the efficiency of antigen presentation of the immune response. Several genetic diseases are associated with defects in the ubiquitin-proteasome pathway. Some examples of affected proteins include those linked to cystic fibrosis (CF transmembrane regulator), Angelman's syndrome (E6-AP), and Liddle syndrome (endothelial sodium channels).

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 9

Alternate Names

Proteasome subunit beta-1i, PSMB9, RING12

Gene Symbol

PSMB9

Additional LMP2/PSMB9 Products

Product Documents for LMP2/PSMB9 Antibody (7Q2G4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LMP2/PSMB9 Antibody (7Q2G4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...