LMX1A Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84141

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84141-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

1 mg/ml

View all LMX1A Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LMX1A. Peptide sequence: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LMX1A Antibody

Western Blot: LMX1A Antibody [NBP2-84141]

Western Blot: LMX1A Antibody [NBP2-84141]

Western Blot: LMX1A Antibody [NBP2-84141] - Host: Rabbit. Target Name: LMX1A. Sample Type: MCF7. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: LMX1A Antibody [NBP2-84141]

Immunohistochemistry: LMX1A Antibody [NBP2-84141]

Immunohistochemistry: LMX1A Antibody [NBP2-84141] - Rabbit Anti-LMX1A Antibody. Paraffin Embedded Tissue: Human Muscle. Cellular Data: Skeletal muscle cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Western Blot: LMX1A Antibody [NBP2-84141]

Western Blot: LMX1A Antibody [NBP2-84141]

Western Blot: LMX1A Antibody [NBP2-84141] - WB Suggested Anti-LMX1A Antibody Titration: 0.3125ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysate
View 1 more images

Applications for LMX1A Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMX1A

Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al., 1994 [PubMed 7698771]).[supplied by OMIM]

Alternate Names

LIM homeobox transcription factor 1, alpha, LMX1.1

Gene Symbol

LMX1A

Additional LMX1A Products

Product Documents for LMX1A Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LMX1A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.