LPCAT3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10074

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10074-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all LPCAT3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LPCAT3 (NP_005759.4). Peptide sequence TVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRH

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LPCAT3 Antibody

Western Blot: LPCAT3 Antibody [NBP3-10074]

Western Blot: LPCAT3 Antibody [NBP3-10074]

Western Blot: LPCAT3 Antibody [NBP3-10074] - Western blot analysis of LPCAT3 in Human Hela Whole Cell lysates. Antibody dilution at 1ug/ml

Applications for LPCAT3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LPCAT3

Acyltransferase which mediates the conversion of lysophosphatidylcholine (1-acyl-sn-glycero-3-phosphocholine or LPC) into phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine or PC) (LPCAT activity). Catalyzes also the conversion of lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) into phosphatidylserine (1,2-diacyl-sn-glycero-3-phospho-L-serine or PS) (LPSAT activity). Has also weak lysophosphatidylethanolamine acyltransferase activity (LPEAT activity). Favors polyunsaturated fatty acyl-CoAs as acyl donors compared to saturated fatty acyl-CoAs. Seems to be the major enzyme contributing to LPCAT activity in the liver. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle

Alternate Names

1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, C3F, EC 2.3.1.-, EC 2.3.1.23, EC 2.3.1.n6, LPCAT, LPLAT 5, Lyso-PC acyltransferase, Lyso-PC acyltransferase 3, Lysophosphatidylcholine acyltransferase, lysophosphatidylcholine acyltransferase 3LPSAT, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 5, Lyso-PS acyltransferase, MBOAT5OACT5, membrane bound O-acyltransferase domain containing 5, Membrane-bound O-acyltransferase domain-containing protein 5, nessy, O-acyltransferase (membrane bound) domain containing 5, O-acyltransferase domain-containing protein 5, putative protein similar to nessy

Gene Symbol

LPCAT3

Additional LPCAT3 Products

Product Documents for LPCAT3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LPCAT3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.