Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92982

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-92982-0.02ml
NBP2-92982-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Lysine (K)-specific Demethylase 6B/KDM6B Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 (NP_001017426.1). LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

176 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of mouse brain, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST
Immunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]

Immunocytochemistry/ Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody - Azide and BSA Free [NBP2-92982]

Immunocytochemistry/Immunofluorescence: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of U2OS cells using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 AntibodyAzide and BSA Free [NBP2-92982]

Western Blot: Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 Antibody [NBP2-92982] - Analysis of extracts of various cell lines, using Lysine (K)-specific Demethylase 6B/KDM6B/JMJD3 .Exposure time: 90s.
View 1 more images

Applications

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lysine (K)-specific Demethylase 6B/KDM6B

JMJD3 is a histone demethylase that specifically demethylates trimethylated and dimethylated 'Lys-27' of histone H3, thereby playing a central role in histone code. JMJD3 is also important for the regulation of posterior development by regulating HOX gene expression. JMJD3 is involved in inflammatory response by participating in macrophage differentiation in case of inflammation by regulating gene expression and macrophage differentiation. It has also been shown to be essential to mammalian epidermal differentiation and is upregulated in prostate cancer.

JMJD3 antibodies are useful tools for epigenetics research and specifically for histone modification studies.

Alternate Names

JMJD3, KDM6B, Lysine (K)specific Demethylase 6B

Gene Symbol

KDM6B

Additional Lysine (K)-specific Demethylase 6B/KDM6B Products

Product Documents

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.