Lysosomal Pro-X Carboxypeptidase/PRCP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17883

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-17883-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Lysosomal Pro-X Carboxypeptidase/PRCP Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody

Western Blot: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Western Blot: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Western Blot: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG
Immunocytochemistry/ Immunofluorescence: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Immunocytochemistry/ Immunofluorescence: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883]

Immunocytochemistry/Immunofluorescence: Lysosomal Pro-X Carboxypeptidase/PRCP Antibody [NBP3-17883] - Staining of human cell line U-2 OS shows localization to vesicles.

Applications for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, pH 7.2, 40% glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lysosomal Pro-X Carboxypeptidase/PRCP

PRCP is encoded by this gene is a lysosomal prolylcarboxypeptidase, which cleaves C-terminal amino acids linked to proline in peptides such as angiotension II, III and des-Arg9-bradykinin. The cleavage occurs at acidic pH, but the enzyme activity is retained with some substrates at neutral pH. This enzyme has been shown to be an activator of the cell matrix-associated prekallikrein. The importance of angiotension II, one of the substrates of this enzyme, in regulating blood pressure and electrolyte balance suggests that this gene may be related to essential hypertension. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Alternate Names

Angiotensinase C, HUMPCP, Prolylcarboxypeptidase

Gene Symbol

PRCP

Additional Lysosomal Pro-X Carboxypeptidase/PRCP Products

Product Documents for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Lysosomal Pro-X Carboxypeptidase/PRCP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.