Lysyl tRNA synthetase Antibody (2V2B6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16670

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16670-100ul
NBP3-16670-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2V2B6

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Lysyl tRNA synthetase Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 500-597 of human Lysyl tRNA synthetase (Q15046). TELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysyl tRNA synthetase Antibody (2V2B6)

Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Western blot analysis of extracts of various cell lines, using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of U-2 OS cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunohistochemistry of paraffin-embedded mouse spinal cord using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 3 more images

Applications for Lysyl tRNA synthetase Antibody (2V2B6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lysyl tRNA synthetase

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis

Alternate Names

CMTRIB, EC 6.1.1, EC 6.1.1.6, KARS2, KIAA0070, KRS, lysine tRNA ligase, Lysine--tRNA ligase, LysRS, lysyl-tRNA synthetase

Gene Symbol

KARS1

Additional Lysyl tRNA synthetase Products

Product Documents for Lysyl tRNA synthetase Antibody (2V2B6)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Lysyl tRNA synthetase Antibody (2V2B6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.