MafG Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82280

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82280-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all MafG Antibodies »

Product Summary for MafG Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAFG. Peptide sequence: MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MafG Antibody

Western Blot: MafG Antibody [NBP2-82280]

Western Blot: MafG Antibody [NBP2-82280]

Western Blot: MafG Antibody [NBP2-82280] - Host: Rabbit. Target Name: MAFG. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml
Western Blot: MafG Antibody [NBP2-82280]

Western Blot: MafG Antibody [NBP2-82280]

Western Blot: MafG Antibody [NBP2-82280] - Host: Rat. Target Name: MAFG. Sample Tissue: Rat Skeletal Muscle. Antibody Dilution: 1ug/ml

Applications for MafG Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MafG

Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Activates globin gene expression when associated with NF-E2. May be involved in signal transduction of extracellular H(+)

Long Name

v-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog G

Alternate Names

basic leucine zipper transcription factor MafG, hMAF, MGC13090, MGC20149, transcription factor MafG, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein G, V-maf musculoaponeurotic fibrosarcoma oncogene homolog G, v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)

Gene Symbol

MAFG

Additional MafG Products

Product Documents for MafG Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MafG Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.