Methionine Sulfoxide Reductase A Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-36719

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-36719-100ul
NBP3-36719-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Methionine Sulfoxide Reductase A Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 24-235 of human Methionine Sulfoxide Reductase A (NP_036463.1).

Sequence:
GNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Methionine Sulfoxide Reductase A Antibody

Methionine Sulfoxide Reductase A Antibody

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-36719] -

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-36719] - Immunofluorescence analysis of PC-12 cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Methionine Sulfoxide Reductase A Antibody

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP3-36719] -

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP3-36719] - Western blot analysis of various lysates using Methionine Sulfoxide Reductase A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Methionine Sulfoxide Reductase A Antibody

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-36719] -

Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP3-36719] - Immunofluorescence analysis of NIH/3T3 cells using Methionine Sulfoxide Reductase A Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
View 1 more images

Applications for Methionine Sulfoxide Reductase A Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Methionine Sulfoxide Reductase A

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase

Gene Symbol

MSRA

Additional Methionine Sulfoxide Reductase A Products

Product Documents for Methionine Sulfoxide Reductase A Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Methionine Sulfoxide Reductase A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.