Microsomal Glutathione S-transferase 1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-92116

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-92116
NBP1-92116-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Microsomal Glutathione S-transferase 1 Antibodies »

Product Summary for Microsomal Glutathione S-transferase 1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FYRLTRKVFANPEDCVAFGKGENAKKYLRTDDR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Microsomal Glutathione S-transferase 1 Antibody

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116] - Staining in human liver and skeletal muscle tissues using anti-MGST1 antibody. Corresponding MGST1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunocytochemistry/ Immunofluorescence: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunocytochemistry/Immunofluorescence: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116]

Immunohistochemistry-Paraffin: Microsomal Glutathione S-transferase 1 Antibody [NBP1-92116] - Staining of human liver shows high expression.
View 1 more images

Applications for Microsomal Glutathione S-transferase 1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Microsomal Glutathione S-transferase 1

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. [provided by RefSeq]

Alternate Names

glutathione S-transferase 12, GST12EC 2.5.1.18, MGC14525, MGST, MGST-I, microsomal glutathione S-transferase 1, Microsomal GST-1, Microsomal GST-I

Gene Symbol

MGST1

Additional Microsomal Glutathione S-transferase 1 Products

Product Documents for Microsomal Glutathione S-transferase 1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Microsomal Glutathione S-transferase 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.