MKP-1/DUSP1 Antibody (3A9)

Novus Biologicals, part of Bio-Techne | Catalog # H00001843-M05

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00001843-M05
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3A9

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all MKP-1 Antibodies »

Product Specifications

Immunogen

DUSP1 (NP_004408, 305 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

Specificity

DUSP1 - dual specificity phosphatase 1 (3A9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MKP-1/DUSP1 Antibody (3A9)

Immunocytochemistry/ Immunofluorescence: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05]

Immunocytochemistry/ Immunofluorescence: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05]

Immunocytochemistry/Immunofluorescence: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05] - Analysis of monoclonal antibody to DUSP1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05] - Detection limit for recombinant GST tagged DUSP1 is 0.3 ng/ml as a capture antibody.

Applications for MKP-1/DUSP1 Antibody (3A9)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MKP-1

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq]

Long Name

MAP Kinase Phosphatase 1

Alternate Names

CL100, DUSP1, HVH1, MKP1, PTPN10

Entrez Gene IDs

1843 (Human)

Gene Symbol

DUSP1

UniProt

NP_004408 (Human)

Additional MKP-1 Products

Product Documents for MKP-1/DUSP1 Antibody (3A9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for MKP-1/DUSP1 Antibody (3A9)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.