MMP20 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82287

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82287-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all MMP20 Antibodies »

Product Summary for MMP20 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse MMP20. Peptide sequence: LNFVRINSGEADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MMP20 Antibody

Western Blot: MMP20 Antibody [NBP2-82287]

Western Blot: MMP20 Antibody [NBP2-82287]

Western Blot: MMP20 Antibody [NBP2-82287] - Host: Rabbit. Target Name: MMP20. Sample Tissue: Mouse Thymus lysates. Antibody Dilution: 1ug/ml

Applications for MMP20 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP20

MMP-20 (enamelysin) is a recently discovered member of the MMP family. This enzyme is involved in the degradation of the various components of the extracellular matrix (ECM) during development, haemostasis and pathological conditions. MMP-20 expression has been found to be restricted to the enamel organ and due to its unique expression pattern, may primarily be involved in the turnover of these molecules during tooth development. The enamel matrix proteins amelogenin, ameloblastin, and enamelin are expressed during the developmental time period, suggesting that MMP-20 may play a role in their hydrolysis (1). Recombinant human enamelysin is able to degrade amelogenin, the major protein component of the enamel matrix. On the basis of its degrading activity on amelogenin, and its highly restricted expression to dental tissues, we suggest that human enamelysin plays a central role in the process of tooth enamel formation (2). Enamelysin null mice do not process amelogenin properly, possesses an altered enamel matrix and rod pattern, has hypoplastic enamel that delaminates from the dentin, and has a deteriorating enamel organ morphology as development progresses (3).

Long Name

Matrix metalloproteinase-20

Alternate Names

EC 3.4.24.-, Enamelysin, MMP-20

Gene Symbol

MMP20

Additional MMP20 Products

Product Documents for MMP20 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MMP20 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.