Myosin heavy chain 13 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-05614
Key Product Details
Species Reactivity
Mouse, Rat
Applications
Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human Myosin heavy chain 13 (NP_003793.2). EALSKSKSNIERTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
223 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Myosin heavy chain 13 Antibody - Azide and BSA Free
Western Blot: Myosin heavy chain 13 AntibodyAzide and BSA Free [NBP3-05614]
Western Blot: Myosin heavy chain 13 Antibody [NBP3-05614] - Western blot analysis of extracts of various cell lines, using Myosin heavy chain 13 antibody (NBP3-05614) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 13 Antibody - Azide and BSA Free [NBP3-05614] -
Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 13 Antibody - Azide and BSA Free [NBP3-05614] - Immunofluorescence analysis of paraffin-embedded rat eye using Myosin heavy chain 13 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 13 Antibody - Azide and BSA Free [NBP3-05614] -
Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 13 Antibody - Azide and BSA Free [NBP3-05614] - Immunofluorescence analysis of paraffin-embedded mouse eye using Myosin heavy chain 13 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for Myosin heavy chain 13 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:100
Immunohistochemistry
1:50 - 1:100
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Myosin heavy chain 13
Alternate Names
MYH13, MYH13 myosin, heavy chain 13, skeletal muscle, MyHC-eo
Gene Symbol
MYH13
Additional Myosin heavy chain 13 Products
Product Documents for Myosin heavy chain 13 Antibody - Azide and BSA Free
Product Specific Notices for Myosin heavy chain 13 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov