Skip to main content

NAT1 Antibody [Alexa Fluor® 350]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35579AF350

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human

Applications

ELISA, Western Blot

Label

Alexa Fluor 350 (Excitation = 346 nm, Emission = 442 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human NAT1 (NP_001153646.1).

Sequence:
MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for NAT1 Antibody [Alexa Fluor® 350]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: NAT1

NAT1 is a gene that codes for a protein that helps in the detoxification of various hydrazine and arylamine drugs as well as to bioactivate several carcinogens and is 290 amino acids long with a weight of approximately 34 kDa. Current studies are being done on several diseases and disorders related to this gene including neural tube defect, drug-induced hepatitis, talipes equinovarus, spina bifida, multiple chemical sensitivity, malignant pleural mesothelioma, non-Hodgkin lymphoma, cleft palate, familial adenomatous polyposis, substance abuse, orofacial cleft, peptic ulcer, lymphoblastic leukemia, systemic lupus erythematosus, cystic fibrosis, lupus erythematosus, Hodgkin's lymphoma, inflammatory bowel disease, and motor neuron disease. NAT1 has also been shown to have interactions with NAA10, SNTA1, SYP1A2, CYP2A6, and XDH in pathways such as the arylamine metabolism, acetylation, and drug metabolism pathways.

Alternate Names

AAC1N-acetyltransferase type 1, Arylamide acetylase 1, arylamine N-acetyltransferase 1, EC 2.3.1.5, MNAT, Monomorphic arylamine N-acetyltransferase, N-acetyltransferase 1 (arylamine N-acetyltransferase), NAT-1, NATI

Gene Symbol

NAT1

Additional NAT1 Products

Product Documents for NAT1 Antibody [Alexa Fluor® 350]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NAT1 Antibody [Alexa Fluor® 350]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...