Nav1.5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86727

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86727
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Nav1.5 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Nav1.5. Peptide sequence: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nav1.5 Antibody

Western Blot: Nav1.5 Antibody [NBP2-86727]

Western Blot: Nav1.5 Antibody [NBP2-86727]

Western Blot: Nav1.5 Antibody [NBP2-86727] - Host: Rabbit. Target Name: SCN5A. Sample Type: MCF7 Whole Cell. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml. Peptide Concentration: 5ug/ml. Lysate Quantity: 25ug/lane/Lane. Gel Concentration: 0.12
Western Blot: Nav1.5 Antibody [NBP2-86727]

Western Blot: Nav1.5 Antibody [NBP2-86727]

Western Blot: Nav1.5 Antibody [NBP2-86727] - WB Suggested Anti-SCN5A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: SW620 cell lysateSCN5A is supported by BioGPS gene expression data to be expressed in SW620
Western Blot: Nav1.5 Antibody [NBP2-86727]

Western Blot: Nav1.5 Antibody [NBP2-86727]

Western Blot: Nav1.5 Antibody [NBP2-86727] - Host: Rabbit. Target Name: SCN5A. Sample Tissue: Human A172 Whole Cell. Antibody Dilution: 1ug/ml

Applications for Nav1.5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nav1.5

Nav1.5 is encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The encoded protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in two transcript variants encoding separate isoforms which differ by a single amino acid. Mutation nomenclature has been assigned with respect to the longer isoform. This antibody is expected to recognise both reported isoforms (NP_000326 and NP_932173).

Long Name

Sodium channel protein type 5 subunit alpha

Alternate Names

SCN5A

Gene Symbol

SCN5A

Additional Nav1.5 Products

Product Documents for Nav1.5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nav1.5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.