NDUFA1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49127

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49127
NBP2-49127-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all NDUFA1 Antibodies »

Product Summary for NDUFA1 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKG

Reactivity Notes

Mouse (82%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFA1 Antibody

Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127]

Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127]

Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127] - Staining of human skin shows low expression as expected.
Immunohistochemistry: NDUFA1 Antibody [NBP2-49127]

Immunohistochemistry: NDUFA1 Antibody [NBP2-49127]

Immunohistochemistry: NDUFA1 Antibody [NBP2-49127] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127]

Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127]

Immunohistochemistry-Paraffin: NDUFA1 Antibody [NBP2-49127] - Staining in human heart muscle and skin tissues using anti-NDUFA1 antibody. Corresponding NDUFA1 RNA-seq data are presented for the same tissues.

Applications for NDUFA1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFA1

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Alternate Names

CI-MWFEcomplex I MWFE subunit, Complex I-MWFE, MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, NADH oxidoreductase subunit MWFE, NADH:ubiquinone oxidoreductase (complex 1), NADH-ubiquinone oxidoreductase MWFE subunit, type I dehydrogenase, ZNF183

Gene Symbol

NDUFA1

Additional NDUFA1 Products

Product Documents for NDUFA1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NDUFA1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.