NFYC Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87910

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87910
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all NFYC Antibodies »

Product Summary for NFYC Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NFYC. Peptide sequence: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NFYC Antibody

Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910] - WB Suggested Anti-NFYC Antibody Titration: 0.25 ug/ml. Positive Control: 293T cells lysateThere is BioGPS gene expression data showing that NFYC is expressed in HEK293T
Immunohistochemistry: NFYC Antibody [NBP2-87910]

Immunohistochemistry: NFYC Antibody [NBP2-87910]

Immunohistochemistry: NFYC Antibody [NBP2-87910] - Human Liver
Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910]

Western Blot: NFYC Antibody [NBP2-87910] - Host: Mouse. Target Name: NFYC. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

Applications for NFYC Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NFYC

NFYC encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. Additional regulation, preliminarily supported by the EST database, may be represented by alternative splicing in this subunit.

Alternate Names

C subunit, nuclear transcription factor Y, gamma

Gene Symbol

NFYC

Additional NFYC Products

Product Documents for NFYC Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NFYC Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.