Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85380

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-85380-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Nicotinic Acetylcholine R alpha 1/CHRNA1. Peptide sequence: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

Western Blot: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-85380]

Western Blot: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-85380]

Western Blot: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-85380] - Host: Rabbit. Target Name: CHRNA1. Sample Tissue: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-85380]

Immunohistochemistry: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-85380]

Immunohistochemistry: Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody [NBP2-85380] - Human Intestine

Applications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 1/CHRNA1

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Long Name

Nicotinic Acetylcholine Receptor alpha 1

Alternate Names

ACHRA, CHRNA1, CMS2A, FCCMS, nAChR alpha 1, nAchRa1, Nicotinic Acetylcholine Ra1, SCCMS

Gene Symbol

CHRNA1

Additional Nicotinic Acetylcholine R alpha 1/CHRNA1 Products

Product Documents for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 1/CHRNA1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.