Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79948

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79948
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Rat

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human CHRNA7. Peptide sequence QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28763248).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948]

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948]

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948] - Host: Rat. Target Name: CHRNA7. Sample Tissue: Rat Brain. Antibody Dilution: 1ug/ml
Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948]

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948]

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948] - MDA-MB-435S Cell lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948]

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948]

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP1-79948] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
View 2 more images

Applications for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-79948 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 7/CHRNA7

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediatefast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits.The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conservedtransmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminalextracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeabilityto calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to,alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation thataffects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene islocated in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomallocation involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event inthis region results in a hybrid containing sequence from this gene and a novel FAM7A gene. (provided by RefSeq)

Long Name

Nicotinic Acetylcholine Receptor alpha 7

Alternate Names

CHRNA7, CHRNA7-2, Nicotinic Acetylcholine Ra 7

Gene Symbol

CHRNA7

UniProt

NP_000737

Additional Nicotinic Acetylcholine R alpha 7/CHRNA7 Products

Product Documents for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.