NRBF2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38273

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-38273-100ul
NBP3-38273-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all NRBF2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-287 of human NRBF2 (NP_110386.2).

Sequence:
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NRBF2 Antibody

NRBF2 Antibody

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] -

Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of U-2 OS cells using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NRBF2 Antibody

Western Blot: NRBF2 Antibody [NBP3-38273] -

Western Blot: NRBF2 Antibody [NBP3-38273] - Western blot analysis of lysates from HepG2 cells, using [KO Validated] NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3min.
NRBF2 Antibody

Western Blot: NRBF2 Antibody [NBP3-38273] -

Western Blot: NRBF2 Antibody [NBP3-38273] - Western blot analysis of various lysates using NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 90s.
View 5 more images

Applications for NRBF2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NRBF2

NRBF2 (nuclear receptor binding factor-2) was originally identified in a yeast two-hybrid screen for factors that interact with the peroxisome proliferator-activated receptor alpha (PPARalpha). In a second study, NRBF2 was also identified in a screen of a keratinocyte cDNA library and named COPR (comodulator of PPAR and RXR). In this study, NRBF2 was proposed to function as a modulator of transcriptional activity that functions to decrease rather than completely repress nuclear-receptor mediated gene expression. Alternative names for NRBF2 include COPR1, COPR2, and NRBF-2.

Alternate Names

Comodulator of PPAR and RXR, COPR, COPR1, COPR2, DKFZp564C1664, FLJ30395, NRBF-2, nuclear receptor binding factor 2, nuclear receptor binding factor-2, nuclear receptor-binding factor 2

Gene Symbol

NRBF2

Additional NRBF2 Products

Product Documents for NRBF2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NRBF2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.