NRIP Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87941

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87941
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all NRIP Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NRIP. Peptide sequence: LMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NRIP Antibody

Western Blot: NRIP Antibody [NBP2-87941]

Western Blot: NRIP Antibody [NBP2-87941]

Western Blot: NRIP Antibody [NBP2-87941] - Host: Rabbit. Target Name: IQWD1. Sample Type: OVCAR-3 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for NRIP Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRIP

WD-repeat proteins are a large family of eukaryotic proteins coordinating multi-protein complex assemblies. Their role has been implicated in multiple cellular processes including signal transduction, transcriptional regulation, cell cycle control and apoptosis. NRIP is a novel 860a.a nuclear protein consisting of seven conserved WD40 domains and one NLS motif. It binds to androgen and glucocorticoid receptors and up-regulates their transcriptional activity, thereby functioning as a nuclear receptor co-activator. Role of NRIP has been implicated in cell growth and also in cervical and prostrate cancer, thus indicating a potential therapeutic intervention. Northern Blot analysis detects a high expression of NRIP in skeletal muscle and testis and low expression in heart, prostrate and adrenal gland.

Alternate Names

1200006M05Rik, Androgen receptor complex-associated protein, ARCAP, DDB1 and CUL4 associated factor 6, DDB1- and CUL4-associated factor 6, FLJ23798, IQ motif and WD repeat-containing protein 1, IQ motif and WD repeats 1, IQWD1, MSTP055, NRIP, Nuclear receptor interaction protein, PC326

Gene Symbol

DCAF6

Additional NRIP Products

Product Documents for NRIP Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NRIP Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.