NUDT21 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57491

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-57491
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all NUDT21 Antibodies »

Product Summary for NUDT21 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUDT21 Antibody

Western Blot: NUDT21 Antibody [NBP2-57491]

Western Blot: NUDT21 Antibody [NBP2-57491]

Western Blot: NUDT21 Antibody [NBP2-57491] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NUDT21 Antibody [NBP2-57491]

Immunocytochemistry/ Immunofluorescence: NUDT21 Antibody [NBP2-57491]

Immunocytochemistry/Immunofluorescence: NUDT21 Antibody [NBP2-57491] - Staining of human cell line PC-3 shows localization to nuclear bodies. Antibody staining is shown in green.

Applications for NUDT21 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUDT21

NUDT21 is encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Alternate Names

CFIm25, CFIM25CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, Cleavage and polyadenylation specificity factor 25 kDa subunit, cleavage and polyadenylation specificity factor subunit 5, CPSF25, CPSF5DKFZp686H1588, Nucleoside diphosphate-linked moiety X motif 21, nudix (nucleoside diphosphate linked moiety X)-type motif 21, Nudix motif 21, pre-mRNA cleavage factor Im (25kD), Pre-mRNA cleavage factor Im 25 kDa subunit, pre-mRNA cleavage factor Im, 25kD subunit

Gene Symbol

NUDT21

Additional NUDT21 Products

Product Documents for NUDT21 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NUDT21 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.