NUFIP1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82515

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82515
NBP1-82515-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all NUFIP1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNM

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUFIP1 Antibody

Immunocytochemistry/ Immunofluorescence: NUFIP1 Antibody [NBP1-82515]

Immunocytochemistry/ Immunofluorescence: NUFIP1 Antibody [NBP1-82515]

Immunocytochemistry/Immunofluorescence: NUFIP1 Antibody [NBP1-82515] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NUFIP1 Antibody [NBP1-82515]

Immunohistochemistry-Paraffin: NUFIP1 Antibody [NBP1-82515]

Immunohistochemistry-Paraffin: NUFIP1 Antibody [NBP1-82515] - Staining of human testis shows strong positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry: NUFIP1 Antibody [NBP1-82515]

Immunohistochemistry: NUFIP1 Antibody [NBP1-82515]

Immunohistochemistry: NUFIP1 Antibody [NBP1-82515] - Staining of human vagina shows nuclear positivity in squamous epithelial cells.
View 3 more images

Applications for NUFIP1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUFIP1

NUFIP1, also known as Nuclear fragile X mental retardation-interacting protein 1, is a 495 amino acid protein that is 56 kDa, binds RNA, contains a C2H2 zinc finger motif and a nuclear localization signal, it is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. Current research is being performed on several diseases and disorders including intellectual disability, neuronitis, microcephaly, and prostatitis. This protein has been shown to have interactions with YWHAZ, BRCA1, CCNT1, RUVBL2, FMR1, and over 30 other proteins in box C/D snoRNP assembly, RNA processing, and positive regulation of transcription from RNA polymerase II promoter pathways.

Alternate Names

bA540M5.1, nuclear fragile X mental retardation protein interacting protein 1, nuclear fragile X mental retardation protein-interacting protein 1, nuclear fragile X mental retardation-interacting protein 1, NUFIP, NUFIPNuclear FMRP-interacting protein 1

Gene Symbol

NUFIP1

Additional NUFIP1 Products

Product Documents for NUFIP1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for NUFIP1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.