NUP133 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10998

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10998-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all NUP133 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NUP133 (NP_060700.2). Peptide sequence QVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NUP133 Antibody

Western Blot: NUP133 Antibody [NBP3-10998]

Western Blot: NUP133 Antibody [NBP3-10998]

Western Blot: NUP133 Antibody [NBP3-10998] - Western blot analysis of NUP133 in Human HepG2 Whole Cell lysates. Antibody dilution at 3ug/ml

Applications for NUP133 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUP133

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.

Alternate Names

FLJ10814, hNUP133,133 kDa nucleoporin, MGC21133, nuclear pore complex protein Nup133, nucleoporin 133kD, nucleoporin 133kDa, Nucleoporin Nup133

Gene Symbol

NUP133

Additional NUP133 Products

Product Documents for NUP133 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NUP133 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.