OR2L2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09770

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09770-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all OR2L2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2L2 (NP_001004686). Peptide sequence HLTVVSFYYAPFAYTYVRPRSLRSPTEDKILAVFYTILTPMLNPIIYSLR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR2L2 Antibody

Western Blot: OR2L2 Antibody [NBP3-09770]

Western Blot: OR2L2 Antibody [NBP3-09770]

Western Blot: OR2L2 Antibody [NBP3-09770] - Western blot analysis of OR2L2 in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for OR2L2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 1 using NBP3-09770 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2L2

OR2L2, also known as Olfactory receptor 2L2, is a 35.5 kDa, 312 amino acid protein that is involved in reception and transduction of olfactory signals to initiate the perception of smell. Current research is linking the protein to diseases such as neuronitis. The protein interacts in signaling by GPCR and olfactory transduction pathways with proteins such as ARRB2, ADRBK2, and GNAL.

Alternate Names

HSHTPCRH07, HTPCRH07OR1-48, Olfactory receptor 2L12, olfactory receptor 2L2, Olfactory receptor 2L4, olfactory receptor OR1-48 pseudogene, olfactory receptor, family 2, subfamily L, member 12, olfactory receptor, family 2, subfamily L, member 2, olfactory receptor, family 2, subfamily L, member 4 pseudogene, OR2L12, OR2L4P

Gene Symbol

OR2L2

Additional OR2L2 Products

Product Documents for OR2L2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for OR2L2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.