ORP8 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59814

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59814
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all ORP8 Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the N terminal of OSBPL8. Peptide sequence SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ORP8 Antibody

Western Blot: ORP8 Antibody [NBP1-59814]

Western Blot: ORP8 Antibody [NBP1-59814]

Western Blot: ORP8 Antibody [NBP1-59814] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: 721_B cell lysate OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Immunohistochemistry: ORP8 Antibody [NBP1-59814]

Immunohistochemistry: ORP8 Antibody [NBP1-59814]

Immunohistochemistry: ORP8 Antibody [NBP1-59814] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm and plasma membrane in Kupffer cells and sinusoids Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: ORP8 Antibody [NBP1-59814]

Western Blot: ORP8 Antibody [NBP1-59814]

Western Blot: ORP8 Antibody [NBP1-59814] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for ORP8 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORP8

OSBPL8 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, OSBPL8 contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain.This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

MGC126578, MGC133203, MST120, MSTP120, ORP-8, ORP8KIAA1451, OSBP10DKFZp686A11164, OSBP-related protein 8, oxysterol binding protein-like 8, oxysterol-binding protein-related protein 8

Gene Symbol

OSBPL8

UniProt

Q68D75 (Human)

Additional ORP8 Products

Product Documents for ORP8 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ORP8 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.