P4HA3 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-94641

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-94641-0.02ml
NBP2-94641-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all P4HA3 Antibodies »

Product Summary for P4HA3 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1). DPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEARLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEAS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for P4HA3 Antibody - Azide and BSA Free

Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 Antibody [NBP2-94641] - Western blot analysis of extracts of various cell lines, using P4HA3 antibody (NBP2-94641) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.
Immunocytochemistry/ Immunofluorescence: P4HA3 Antibody - Azide and BSA Free [NBP2-94641]

Immunocytochemistry/ Immunofluorescence: P4HA3 Antibody - Azide and BSA Free [NBP2-94641]

Immunocytochemistry/Immunofluorescence: P4HA3 Antibody [NBP2-94641] - Analysis of NIH/3T3 cells using P4HA3 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 AntibodyAzide and BSA Free [NBP2-94641]

Western Blot: P4HA3 Antibody [NBP2-94641] - Analysis of extracts of 293T cells, using P4HA3 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time:

Applications for P4HA3 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:1000 - 1:5000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: P4HA3

The P4HA3 gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part o

Alternate Names

2-oxoglutarate-4-dioxygenase subunit alpha-3, 4-PH alpha-3, alpha polypeptide III, collagen prolyl 4-hydroxylase alpha(III), C-P4H alpha III, C-P4Halpha(III), EC 1.14.11.2, Procollagen-proline, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), prolyl 4-hydroxylase subunit alpha-3, prolyl 4-hydroxylase, alpha polypeptide III

Gene Symbol

P4HA3

Additional P4HA3 Products

Product Documents for P4HA3 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for P4HA3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.