PABPC4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58575

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58575
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all PABPC4 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PABPC4 Antibody

Immunocytochemistry/ Immunofluorescence: PABPC4 Antibody [NBP2-58575]

Immunocytochemistry/ Immunofluorescence: PABPC4 Antibody [NBP2-58575]

Immunocytochemistry/Immunofluorescence: PABPC4 Antibody [NBP2-58575] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Western Blot: PABPC4 Antibody [NBP2-58575]

Western Blot: PABPC4 Antibody [NBP2-58575]

Western Blot: PABPC4 Antibody [NBP2-58575] - Analysis in human cell line RT-4 and human cell line U-251 MG.
PABPC4 Antibody Western Blot: PABPC4 Antibody Antibody [NBP2-58575]

Western Blot: PABPC4 Antibody Antibody [NBP2-58575]

Analysis using NBP2-58575 (A) shows similar pattern to independent antibody NBP2-13722 (B).

Applications for PABPC4 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PABPC4

Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules.

Alternate Names

APP1FLJ43938, APP-1PABP-4, Inducible poly(A)-binding protein, IPABP, iPABPpoly(A)-binding protein, cytoplasmic 4 (inducible form), PABP4Activated-platelet protein 1, poly(A) binding protein, cytoplasmic 4 (inducible form), Poly(A)-binding protein 4, polyadenylate-binding protein 4

Gene Symbol

PABPC4

Additional PABPC4 Products

Product Documents for PABPC4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PABPC4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.