PALS1/MPP5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54724

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54724
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PALS1/MPP5 Antibodies »

Product Summary for PALS1/MPP5 Antibody

Immunogen

Synthetic peptides corresponding to MPP5(membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)) The peptide sequence was selected from the N terminal of MPP5 (NP_071919.2). AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PALS1/MPP5 Antibody

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724]

Western Blot: PALS1/MPP5 Antibody [NBP1-54724] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
View 2 more images

Applications for PALS1/MPP5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PALS1/MPP5

Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains (Tseng et al., 2001 [PubMed 11311936]). MPP5 is a member of the p55-like MAGUK subfamily.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Protein Associated with Lin Seven 1

Alternate Names

MPP5, Stardust

Entrez Gene IDs

64398 (Human)

Gene Symbol

MPP5

UniProt

Q8N3R9 (Human)

Additional PALS1/MPP5 Products

Product Documents for PALS1/MPP5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PALS1/MPP5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.