PDE8A Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35230

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-35230-100ul
NBP3-35230-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PDE8A Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PDE8A (NP_002596.1).

Sequence:
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSGKKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PDE8A Antibody

PDE8A Antibody

Western Blot: PDE8A Antibody [NBP3-35230] -

Western Blot: PDE8A Antibody [NBP3-35230] - Western blot analysis of various lysates using PDE8A Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.

Applications for PDE8A Antibody

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PDE8A

Phosphodiesterase type 8 (PDE8) is one of the many phosphodiesterases that compartmentalize and hydrolyze cAMP into AMP. The cAMP-specific PDE8 family is comprised of 2 genes (PDE8A and PDE8B) each with multiple splice variants generated by RNA splicing and use of alternate initiation sites. PDE8 family is a high affinity cAMP-specific, IBMX sensitive PDE. PDE8 has a significant conserved region of about 270 amino acids common to all PDEs at the carboxy terminal apparently serves as the catalytic domain. The amino-terminal region of this protein is divergent and presumably accounts for the distinctive and regulatory properties unique to the individual PDE families. PDE8A protein showed significant homology to other cAMP-dependent PDEs (23%) within the catalytic domain. PDE8A is widely expressed in various tissues in contrast to PDE8B that is exclusively expressed in thyroid gland. The PDE8A transcripts are found in brain, pancreas, placenta, thyroid, spleen, trachea, prostate, and uterus.

Long Name

High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

Alternate Names

cAMP-specific cyclic nucleotide phosphodiesterase 8A, EC 3.1.4.17, FLJ16150, high affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A, high-affinity cAMP-specific and IBMX-insensitive 3'-5'-cyclic phosphodiesterase8A, HsT19550, phosphodiesterase 8A

Gene Symbol

PDE8A

Additional PDE8A Products

Product Documents for PDE8A Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PDE8A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.