Peroxiredoxin 4 Antibody (9E7V0)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16760

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16760-100ul
NBP3-16760-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9E7V0

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Peroxiredoxin 4 Antibodies »

Product Summary for Peroxiredoxin 4 Antibody (9E7V0)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 4 (PRDX4) (Q13162). MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Peroxiredoxin 4 Antibody (9E7V0)

Western Blot: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Western Blot: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Western Blot: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Western blot analysis of extracts of various cell lines, using Peroxiredoxin 4 (PRDX4) Rabbit mAb (NBP3-16760) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Immunocytochemistry/Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunofluorescence analysis of NIH-3T3 cells using Peroxiredoxin 4 (PRDX4) Rabbit mAb (NBP3-16760) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Immunohistochemistry-Paraffin: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Immunohistochemistry-Paraffin: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry of paraffin-embedded mouse brain using Peroxiredoxin 4 (PRDX4) Rabbit mAb (NBP3-16760) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 2 more images

Applications for Peroxiredoxin 4 Antibody (9E7V0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Peroxiredoxin 4

Peroxiredoxin-4 is encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Alternate Names

AOE372, PRDX4, Prx4

Gene Symbol

PRDX4

Additional Peroxiredoxin 4 Products

Product Documents for Peroxiredoxin 4 Antibody (9E7V0)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Peroxiredoxin 4 Antibody (9E7V0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.