PGD2 Synthase/PTGDS Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79280

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79280
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all PGD2 Synthase/PTGDS Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PGD2 Synthase/PTGDS Antibody

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Staining of mouse brain . Image provided by Allison Brager - Department of Neurobiology, Morehouse School of Medicine.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280]

Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for PGD2 Synthase/PTGDS Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 1 review rated 5 using NBP1-79280 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PGD2 Synthase/PTGDS

Prostaglandin D Synthase (PTGDS), is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of amyloid-b plaques in Alzheimer's disease.

Long Name

Prostaglandin D2 Synthase

Alternate Names

Cerebrin-28, PDS, PGD2, PGDS2, PH2DISO, PTGDS

Entrez Gene IDs

5730 (Human); 19215 (Mouse); 25526 (Rat)

Gene Symbol

PTGDS

UniProt

P41222

Additional PGD2 Synthase/PTGDS Products

Product Documents for PGD2 Synthase/PTGDS Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PGD2 Synthase/PTGDS Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.