PHF5A Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-83391

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-83391-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all PHF5A Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PHF5A. Peptide sequence: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PHF5A Antibody

Western Blot: PHF5A Antibody [NBP2-83391]

Western Blot: PHF5A Antibody [NBP2-83391]

Western Blot: PHF5A Antibody [NBP2-83391] - WB Suggested Anti-PHF5A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: OVCAR-3 cell lysate

Applications for PHF5A Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHF5A

PHF5A encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq]

Alternate Names

bK223H9.2, INI, MGC1346, PHD finger protein 5A, PHD finger-like domain protein 5A, PHD finger-like domain-containing protein 5A, PHD-finger 5a, Rds3, SAP14b, SF3b14bSplicing factor 3B-associated 14 kDa protein, splicing factor 3B associated 14 kDa protein

Gene Symbol

PHF5A

Additional PHF5A Products

Product Documents for PHF5A Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PHF5A Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.