PI 3-Kinase p85 beta Antibody (6E2F5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16493

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16493-100ul
NBP3-16493-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6E2F5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PI 3-Kinase p85 beta Antibodies »

Product Summary for PI 3-Kinase p85 beta Antibody (6E2F5)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI 3-Kinase p85 beta (O00459). PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PI 3-Kinase p85 beta Antibody (6E2F5)

Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]

Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]

Western Blot: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493] - Western blot analysis of extracts of various cell lines, using PI 3-Kinase p85 beta antibody (NBP3-16493) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]

Immunohistochemistry-Paraffin: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]

Immunohistochemistry-Paraffin: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493] - Immunohistochemistry of paraffin-embedded mouse testis using PI 3-Kinase p85 beta Rabbit mAb (NBP3-16493) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]

Immunohistochemistry-Paraffin: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493]

Immunohistochemistry-Paraffin: PI 3-Kinase p85 beta Antibody (6E2F5) [NBP3-16493] - Immunohistochemistry of paraffin-embedded rat testis using PI 3-Kinase p85 beta Rabbit mAb (NBP3-16493) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 1 more images

Applications for PI 3-Kinase p85 beta Antibody (6E2F5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PI 3-Kinase p85 beta

The enzyme phosphatidylinositol 3 kinase (PI3 kinase) is a lipid kinase that generates phosphatidylinositol 3, 4, 5-triphosphate in response to receptor activation in many signal transduction pathways. Class IA PI3Ks exist as a heterodimer of a catalytic 110 kDa (p110) and a regulatory p85 subunit (e.g. p85 beta). p85 beta is an adaptor molecule that regulates the activity of the catalytic p110 subunit by binding to phosphorylated receptor tyrosine kinases (RTKs) through its SH2 domain and mediating the interaction between p110 and the plasma membrane. p85 beta is necessary for insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues.

Long Name

Phosphatidylinositol-3-kinase 85 kDa Regulatory Subunit beta

Alternate Names

p85-beta, PI 3Kinase p85 beta, PIK3R2

Gene Symbol

PIK3R2

Additional PI 3-Kinase p85 beta Products

Product Documents for PI 3-Kinase p85 beta Antibody (6E2F5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PI 3-Kinase p85 beta Antibody (6E2F5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.