PKD2L1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-86748

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-86748
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all PKD2L1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PKD2L1. Peptide sequence: QKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQETAY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PKD2L1 Antibody

Western Blot: PKD2L1 Antibody [NBP2-86748]

Western Blot: PKD2L1 Antibody [NBP2-86748]

Western Blot: PKD2L1 Antibody [NBP2-86748] - Host: Rabbit. Target Name: PKD2L1. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for PKD2L1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKD2L1

PKD2L1 encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel. Alternative splice variants have been described but their full length sequences have not been determined; FUNCTION: May function as a subunit of an ion channel and act as a transducer of calcium-mediated signaling. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in adult heart, skeletal muscle, brain, spleen, testis, retina and liver. According to Ref.1 expressed at high levels in fetal tissues, including kidney and liver, and down-regulated in adult tissues. It has been found to be expressed in fetal brain, but not expressed in fetal lung, liver or kidney. Isoform 4 appears to be expressed only in transformed lymphoblasts.

Long Name

Polycystic kidney disease 2-like 1 protein

Alternate Names

PKD2L, PKDL, Polycystin-2L1, Polycystin-L, Polycystin-L1, TRPP3

Gene Symbol

PKD2L1

Additional PKD2L1 Products

Product Documents for PKD2L1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PKD2L1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.