POMZP3 Antibody (2E7)

Novus Biologicals, part of Bio-Techne | Catalog # H00022932-M02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00022932-M02
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2E7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all POMZP3 Antibodies »

Product Specifications

Immunogen

POMZP3 (NP_694537, 64 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNM*

Specificity

POMZP3 - POM (POM121 homolog, rat) and ZP3 fusion

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for POMZP3 Antibody (2E7)

Western Blot: POMZP3 Antibody (2E7) [H00022932-M02]

Western Blot: POMZP3 Antibody (2E7) [H00022932-M02]

Western Blot: POMZP3 Antibody (2E7) [H00022932-M02] - POMZP3 monoclonal antibody (M02), clone 2E7. Analysis of POMZP3 expression in PC-12.
Immunohistochemistry-Paraffin: POMZP3 Antibody (2E7) [H00022932-M02]

Immunohistochemistry-Paraffin: POMZP3 Antibody (2E7) [H00022932-M02]

Immunohistochemistry-Paraffin: POMZP3 Antibody (2E7) [H00022932-M02] - Analysis of monoclonal antibody to POMZP3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: POMZP3 Antibody (2E7) [H00022932-M02]

Western Blot: POMZP3 Antibody (2E7) [H00022932-M02]

Western Blot: POMZP3 Antibody (2E7) [H00022932-M02] - POMZP3 monoclonal antibody (M02), clone 2E7 Analysis of POMZP3 expression in K-562.
View 1 more images

Applications for POMZP3 Antibody (2E7)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: POMZP3

This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3' exons from the ZP3 gene. The 5' end of this gene is similar to the 5` coding region of the POM121 gene which encodes an integral nuclear pore membrane protein. However, the protein encoded by this gene lacks the nuclear pore localization motif. The 3' end of this gene is similar to the last 4 exons of the zona pellucida glycoprotein 3 (ZP3) gene and the encoded protein retains one zona pellucida domain. Multiple protein isoforms are encoded by transcript variants of this gene.

Alternate Names

MGC8359, POM (POM121 rat homolog) and ZP3 fusion, POM121 and ZP3 fusion, POM121 and ZP3 fusion protein, POM121/ZP3 fusion protein, rat) and ZP3 fusion

Entrez Gene IDs

22932 (Human)

Gene Symbol

POMZP3

OMIM

600587 (Human)

UniProt

NP_694537 (Human)

Additional POMZP3 Products

Product Documents for POMZP3 Antibody (2E7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for POMZP3 Antibody (2E7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.